PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678447449
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TALE
Protein Properties Length: 420aa    MW: 47110.3 Da    PI: 6.5825
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678447449genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.91.5e-072963292154
                HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                k +yp++e++++L +++gL+ +q+ +WF N+R +
  678447449 296 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 329
                569*****************************87 PP

2ELK29.31.9e-10250271122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELKh+L+++Y+ +++++++E++
  678447449 250 ELKHELKQGYKDKIVDIREEIL 271
                9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.7E-2084128IPR005540KNOX1
PfamPF037902.2E-1786127IPR005540KNOX1
SMARTSM012561.0E-24137193IPR005541KNOX2
PfamPF037911.4E-17143192IPR005541KNOX2
SMARTSM011885.1E-4250271IPR005539ELK domain
PfamPF037891.4E-5250271IPR005539ELK domain
PROSITE profilePS512139.969250270IPR005539ELK domain
PROSITE profilePS5007111.645270333IPR001356Homeobox domain
SMARTSM003894.6E-11272337IPR001356Homeobox domain
SuperFamilySSF466896.42E-16272336IPR009057Homeodomain-like
CDDcd000862.55E-11273332No hitNo description
Gene3DG3DSA:1.10.10.602.7E-25277334IPR009057Homeodomain-like
PfamPF059209.0E-18290329IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MAFQDHTQMP LHYPDHSSPP STLFRSDKNT PTNWNSSFQQ QQHHHWLPAT AQNQDRASDQ  60
FHDGGGGCWG GDNSSSSNCN WERDKCKADI LSHPLYEELL AAHVACLRIA TPVDQLTRID  120
AQLAQSQQVV AKYSLLAQSQ PPLDQKDLDH FMTHYVLLLS SFKEQLQQHV RVHAMEAVMA  180
CWELEQSLQS LTGVAPGEGT GATMSDDDDD QGDSETNLFD ESVDGPDNMG FGPLVMSESE  240
RSLMERVRQE LKHELKQGYK DKIVDIREEI LRKRRAGKLP GDTTSVLKAW WKSHSKWPYP  300
TEEDKARLVQ ETGLQLKQIN NWFINQRKRN WHSNPSSSSS QKSKRKSGGG DKTGDELSVA  360
GDRAHTEEVH AGHHPRHPDP HRRLSPLSGL PAVLFGCGQE LGRKPGLRGR EPPSSVCEGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A8e-13273337872Homeobox protein PKNOX1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084049.10.0PREDICTED: homeobox protein knotted-1-like LET12 isoform X1
SwissprotO223001e-161LET12_SOLLC; Homeobox protein knotted-1-like LET12
TrEMBLA0A0F6V0901e-167A0A0F6V090_POPTO; TALE transcription factor
TrEMBLM1D1271e-167M1D127_SOLTU; Uncharacterized protein
TrEMBLS8CZT11e-168S8CZT1_9LAMI; Uncharacterized protein (Fragment)
STRINGVIT_11s0118g00800.t011e-165(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14322472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11060.11e-147KNOTTED1-like homeobox gene 4